PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g17982.1.p
Common NameBRADI_2g17982, LOC100846095
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 279aa    MW: 30543.2 Da    PI: 5.1622
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g17982.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161865148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l++ + ++G g+W+++++  g++R++k+c++rw +yl
  Bradi2g17982.1.p 18 KGLWSPEEDEKLYNHIIRHGVGCWSSVPKLAGLHRCGKSCRLRWINYL 65
                      678*******************************************97 PP

2Myb_DNA-binding50.83.9e-1671115147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+++ +E++l+v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  Bradi2g17982.1.p  71 RGSFSLQEEDLIVALHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 115
                       899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2421365IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-231368IPR009057Homeodomain-like
SuperFamilySSF466894.49E-2916112IPR009057Homeodomain-like
SMARTSM007179.6E-141767IPR001005SANT/Myb domain
PfamPF002497.3E-151865IPR001005SANT/Myb domain
CDDcd001673.84E-122165No hitNo description
PROSITE profilePS5129425.2366120IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2569120IPR009057Homeodomain-like
SMARTSM007171.2E-1570118IPR001005SANT/Myb domain
PfamPF002492.2E-1471115IPR001005SANT/Myb domain
CDDcd001671.61E-1173113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGRLSCGGGG GGQAKLRKGL WSPEEDEKLY NHIIRHGVGC WSSVPKLAGL HRCGKSCRLR  60
WINYLRPDLK RGSFSLQEED LIVALHEILG NRWSQIASHL PGRTDNEIKN FWNSCLKKKL  120
RQQGIDPATH KPITAMPDAL PTDAQEDEDQ KPPTGAGALA PNPKQQAVFD PFPAATDFGG  180
VFDHDGLAAV PALFEGVTGD YSSVLDLDSY GESSSNSSNN NWNGCGAEMS NVLDGEALHW  240
APIKDDDDAA LGEHKFLLQM PCQEQMSLPH FDFNLEYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27161205108B-MYB
1h8a_C4e-271612025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115121LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794201e-157HF679420.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB14 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567975.10.0PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-105MYB3_HORVU; Myb-related protein Hv33
TrEMBLI1HGY80.0I1HGY8_BRADI; Uncharacterized protein
STRINGBRADI2G17982.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-73myb domain protein 86